Order before 3pm Mon–Fri for same-day dispatch99%+ Purity Guaranteed on Every BatchDiscreet Plain Packaging on All OrdersFast UK Next-Day Delivery AvailableBatch-Specific COA (See Product)Research Use Only — Not for Human or Veterinary Use15 Years of Experience Supplying UK ResearchersOrder before 3pm Mon–Fri for same-day dispatch99%+ Purity Guaranteed on Every BatchDiscreet Plain Packaging on All OrdersFast UK Next-Day Delivery AvailableBatch-Specific COA (See Product)Research Use Only — Not for Human or Veterinary Use15 Years of Experience Supplying UK Researchers

99%+ Purity

High purity guaranteed on all peptides

Same Day Dispatch

Order before 3PM Mon–Fri

Fast UK Delivery

Next day delivery available (Free Shipping on orders over £200)

Research Use Only

Lab grade quality assured

For research use only. For laboratory research use only. Not for human or veterinary use.

TB500 10mg

Selling fast

Independent lab testing

All vials are vendor tested by Janoshik Analytical (independent third-party laboratory testing). Certificates of Analysis are published on this site for each peptide batch.

Certificate of analysis

Select a product to view its batch Certificate of Analysis. Peptide vials are vendor tested by Janoshik Analytical.

Batch certificate (COA)

HPLC certificate of analysis for this product — view batch identity, purity, and quality fields on our certificate page.

Scan to open verified COA on our site
Scan to verify
Opens the live certificate URL on our domain so you can confirm batch details.

“Print / Save as PDF” opens the certificate in a new tab — then use your browser’s Print dialog and choose Save as PDF if you do not use the hosted file.

10% off when paying in USDT (Crypto)

1823 customers are viewing this product

263 sold in last 24 hours

Ship to
United Kingdom,GB
Shipping to United Kingdom for £ 
Service: Delivery: 

Free UK delivery on orders over £200. Free delivery outside the UK on orders over £300.

Hide
Return Policy
Security & Privacy

Safe payments: We do not share your personal details with any third parties without your consent. Secure personal details: We protect your privacy and keep your personal details safe and secure.

Select quantity
UK SupplierSecure CheckoutFast Dispatch

Discreet plain packaging — all orders are shipped in plain, unbranded packaging with no external product references for your privacy.

You Might Also Like

No Products.

Description

TB-500 10mg (Thymosin Beta-4)

TB-500 is the synthetic research form of Thymosin Beta-4 (Tβ4), a 43-amino-acid peptide abundant in many cell types and involved in actin dynamics, cell motility, and repair-related processes. Laboratory interest spans tissue regeneration, inflammation tone, and vascular remodelling.


Research focus

1. Actin regulation and cell movement

TB-500/Tβ4 research often tracks actin organisation, migration, differentiation, and proliferation—especially in muscle, blood-cell, and wound-site contexts.

2. Angiogenesis and nutrient delivery models

Investigators study new vessel formation and how improved perfusion may support recovering tissues in experimental systems.

3. Recovery and inflammation models

Connective-tissue and muscle-injury protocols examine cellular repair rates, inflammatory modulation, and mobility-related endpoints in research settings only.

4. Follicular biology (exploratory)

Early laboratory work has also considered follicular activity; mechanisms remain under investigation.


Conclusion

TB-500 is a multi-pathway research peptide for actin biology, angiogenesis, and regenerative model systems.

For laboratory research use only. Not approved for human or veterinary applications. Sold by My UK Peptides strictly for scientific research and education.

Storage: Store lyophilised material at −20 °C, protected from light and moisture. After reconstitution, aliquot to avoid repeated freeze–thaw cycles. Reconstituted solutions are typically held at 4 °C for short laboratory use only.

Reconstitution: Reconstitute with bacteriostatic water under aseptic conditions unless the compound notes otherwise.

Technical information

  • Synonyms: Thymosin Beta-4, Tβ4, Timbetasin
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Molecular weight: ~4963 g/mol
  • CAS: 77591-33-4
  • PubChem CID: 16132341

Please do not ask about human consumption as this is forbidden.

What Is TB500 10mg?

TB500 10mg is a research peptide supplied for laboratory and in-vitro experimental use only. It is intended for qualified researchers and laboratory workflows, not for human or veterinary use.

Product Specifications

ProductTB500 10mg Research Peptide
Available Size(s)1
FormatLyophilized research peptide
Testing / DocumentationBatch-specific COA when available
Intended UseLaboratory and in-vitro research only
Human / Animal UseNot for human or animal consumption, application, injection, or clinical use

Research-Use Overview

TB500 10mg is listed for qualified researchers, laboratories, and research organisations that require clear product identification, batch documentation where available, and compliance-forward catalogue information from My UK Peptides (Research Only).

Purity & Third-Party Testing

All peptide vials from My UK Peptides are vendor tested by Janoshik Analytical, an independent third-party laboratory. Batch Certificates of Analysis (COA) are published on this site for verification. A batch-specific Certificate of Analysis (COA) is available on this page for identity and purity review before laboratory use.

Storage & Handling

Keep sealed, protected from direct light, and stored according to your laboratory standard operating procedures. Lyophilised material is typically stored cold and dry. Handling should be performed only by trained personnel using appropriate PPE, labelling, and documentation controls.

Frequently Asked Questions

What sizes are available?

Listed size option(s): 1.

Is this product for human use?

No. This product is supplied strictly for laboratory and in-vitro research only. It is not for human or animal consumption, application, injection, clinical use, or veterinary use.

Is a Certificate of Analysis available?

Yes. Use the Access COA / certificate link on this page to view batch documentation when available.

Who should handle this product?

Only qualified laboratory personnel should handle this material under applicable institutional and legal requirements.

Research Use Only

For laboratory research use only. Not for human or veterinary use. This product is supplied strictly for research purposes only. It is not intended for human or animal consumption and is not intended for therapeutic, dietary, cosmetic, diagnostic, or veterinary use. Statements on this page have not been evaluated by the MHRA or FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.

Specifications

    Research Use Only

    For laboratory research use only. Not for human or veterinary use.

    Not for Human Use

    Products are not intended for human or veterinary consumption.

    Quality Guaranteed

    Rigorous quality control on every batch from our state-of-the-art laboratory.

    © My UK Peptides (Research Only) — All rights reservedUK Peptides Supplier — Established 15 years! Research-use-only products.