My UK Peptides (Research Only)Trusted UK Supplier of Research Peptides Since 2011
UK Peptides Supplier — Established 15 years! Research-use-only products.
Popular Products
Sold OutHospira 30ml Bac Water£50.0099%+ Purity
High purity guaranteed on all peptides
Same Day Dispatch
Order before 3PM Mon–Fri
Fast UK Delivery
Next day delivery available (Free Shipping on orders over £200)
Research Use Only
Lab grade quality assured
TB500 10mg
Categories: Peptides, Research Peptides
Tags: TB500, TB-500, thymosin beta 4, thymosin beta-4, peptide, research, tissue repair
Selling fast
28 customers are viewing this product
12 sold in last 24 hours
My UK Peptides (Research Only) assurance
Free UK delivery on orders over £200. Free delivery outside the UK on orders over £300.
Safe payments: We do not share your personal details with any third parties without your consent. Secure personal details: We protect your privacy and keep your personal details safe and secure.
Discreet plain packaging — all orders are shipped in plain, unbranded packaging with no external product references for your privacy.
You Might Also Like
Description
TB-500 10mg (Thymosin Beta-4)
TB-500 is the synthetic research form of Thymosin Beta-4 (Tβ4), a 43-amino-acid peptide abundant in many cell types and involved in actin dynamics, cell motility, and repair-related processes. Laboratory interest spans tissue regeneration, inflammation tone, and vascular remodelling.
Research focus
1. Actin regulation and cell movement
TB-500/Tβ4 research often tracks actin organisation, migration, differentiation, and proliferation—especially in muscle, blood-cell, and wound-site contexts.
2. Angiogenesis and nutrient delivery models
Investigators study new vessel formation and how improved perfusion may support recovering tissues in experimental systems.
3. Recovery and inflammation models
Connective-tissue and muscle-injury protocols examine cellular repair rates, inflammatory modulation, and mobility-related endpoints in research settings only.
4. Follicular biology (exploratory)
Early laboratory work has also considered follicular activity; mechanisms remain under investigation.
Conclusion
TB-500 is a multi-pathway research peptide for actin biology, angiogenesis, and regenerative model systems.
For laboratory research use only. Not approved for human or veterinary applications. Sold by My UK Peptides strictly for scientific research and education.
Storage: Store lyophilised material at −20 °C, protected from light and moisture. After reconstitution, aliquot to avoid repeated freeze–thaw cycles. Reconstituted solutions are typically held at 4 °C for short laboratory use only.
Reconstitution: Reconstitute with bacteriostatic water under aseptic conditions unless the compound notes otherwise.
Technical information
- Synonyms: Thymosin Beta-4, Tβ4, Timbetasin
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Molecular weight: ~4963 g/mol
- CAS: 77591-33-4
- PubChem CID: 16132341
What Is TB500 10mg?
TB500 10mg is a research peptide supplied for laboratory and in-vitro experimental use only. It is intended for qualified researchers and laboratory workflows, not for human or veterinary use.
Product Specifications
| Product | TB500 10mg Research Peptide |
|---|---|
| Available Size(s) | 1 |
| Format | Lyophilized research peptide |
| Testing / Documentation | Batch documentation when available |
| Intended Use | Laboratory and in-vitro research only |
| Human / Animal Use | Not for human or animal consumption, application, injection, or clinical use |
Research-Use Overview
TB500 10mg is listed for qualified researchers, laboratories, and research organisations that require clear product identification, batch documentation where available, and compliance-forward catalogue information from My UK Peptides (Research Only).
Purity & Third-Party Testing
Quality documentation may vary by batch. When a COA is available, it should be reviewed before laboratory use to confirm identity, lot details, and analytical information relevant to your research workflow.
Storage & Handling
Keep sealed, protected from direct light, and stored according to your laboratory standard operating procedures. Lyophilised material is typically stored cold and dry. Handling should be performed only by trained personnel using appropriate PPE, labelling, and documentation controls.
Frequently Asked Questions
What sizes are available?
Listed size option(s): 1.
Is this product for human use?
No. This product is supplied strictly for laboratory and in-vitro research only. It is not for human or animal consumption, application, injection, clinical use, or veterinary use.
Is a Certificate of Analysis available?
When available, COA or batch documentation should be referenced for identity and quality review before use in any research workflow.
Who should handle this product?
Only qualified laboratory personnel should handle this material under applicable institutional and legal requirements.
Research Use Only
For laboratory research use only. Not for human or veterinary use. This product is supplied strictly for research purposes only. It is not intended for human or animal consumption and is not intended for therapeutic, dietary, cosmetic, diagnostic, or veterinary use. Statements on this page have not been evaluated by the MHRA or FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.
Specifications
Research Use Only
For laboratory research use only. Not for human or veterinary use.
Not for Human Use
Products are not intended for human or veterinary consumption.
Quality Guaranteed
Rigorous quality control on every batch from our state-of-the-art laboratory.