Order before 3pm Mon–Fri for same-day dispatch99%+ Purity Guaranteed on Every BatchDiscreet Plain Packaging on All OrdersFast UK Next-Day Delivery AvailableBatch-Specific COA (See Product)Research Use Only — Not for Human or Veterinary Use15 Years of Experience Supplying UK ResearchersOrder before 3pm Mon–Fri for same-day dispatch99%+ Purity Guaranteed on Every BatchDiscreet Plain Packaging on All OrdersFast UK Next-Day Delivery AvailableBatch-Specific COA (See Product)Research Use Only — Not for Human or Veterinary Use15 Years of Experience Supplying UK Researchers
Research Use Only

My UK Peptides (Research Only)Trusted UK Supplier of Research Peptides Since 2011

UK Peptides Supplier — Established 15 years! Research-use-only products.

99%+ Purity

High purity guaranteed on all peptides

Same Day Dispatch

Order before 3PM Mon–Fri

Fast UK Delivery

Next day delivery available (Free Shipping on orders over £200)

Research Use Only

Lab grade quality assured

For research use only. For laboratory research use only. Not for human or veterinary use.
My UK Peptides
TB500
10MGRESEARCH USE ONLY
Ship to
United Kingdom,GB
Shipping to United Kingdom for £ 
Service: Delivery: 

Free UK delivery on orders over £200. Free delivery outside the UK on orders over £300.

Hide
Return Policy
Security & Privacy

Safe payments: We do not share your personal details with any third parties without your consent. Secure personal details: We protect your privacy and keep your personal details safe and secure.

Select quantity
UK SupplierSecure CheckoutFast Dispatch

Discreet plain packaging — all orders are shipped in plain, unbranded packaging with no external product references for your privacy.

You Might Also Like

No Products.

Description

TB-500 10mg (Thymosin Beta-4)

TB-500 is the synthetic research form of Thymosin Beta-4 (Tβ4), a 43-amino-acid peptide abundant in many cell types and involved in actin dynamics, cell motility, and repair-related processes. Laboratory interest spans tissue regeneration, inflammation tone, and vascular remodelling.


Research focus

1. Actin regulation and cell movement

TB-500/Tβ4 research often tracks actin organisation, migration, differentiation, and proliferation—especially in muscle, blood-cell, and wound-site contexts.

2. Angiogenesis and nutrient delivery models

Investigators study new vessel formation and how improved perfusion may support recovering tissues in experimental systems.

3. Recovery and inflammation models

Connective-tissue and muscle-injury protocols examine cellular repair rates, inflammatory modulation, and mobility-related endpoints in research settings only.

4. Follicular biology (exploratory)

Early laboratory work has also considered follicular activity; mechanisms remain under investigation.


Conclusion

TB-500 is a multi-pathway research peptide for actin biology, angiogenesis, and regenerative model systems.

For laboratory research use only. Not approved for human or veterinary applications. Sold by My UK Peptides strictly for scientific research and education.

Storage: Store lyophilised material at −20 °C, protected from light and moisture. After reconstitution, aliquot to avoid repeated freeze–thaw cycles. Reconstituted solutions are typically held at 4 °C for short laboratory use only.

Reconstitution: Reconstitute with bacteriostatic water under aseptic conditions unless the compound notes otherwise.

Technical information

  • Synonyms: Thymosin Beta-4, Tβ4, Timbetasin
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Molecular weight: ~4963 g/mol
  • CAS: 77591-33-4
  • PubChem CID: 16132341

What Is TB500 10mg?

TB500 10mg is a research peptide supplied for laboratory and in-vitro experimental use only. It is intended for qualified researchers and laboratory workflows, not for human or veterinary use.

Product Specifications

ProductTB500 10mg Research Peptide
Available Size(s)1
FormatLyophilized research peptide
Testing / DocumentationBatch documentation when available
Intended UseLaboratory and in-vitro research only
Human / Animal UseNot for human or animal consumption, application, injection, or clinical use

Research-Use Overview

TB500 10mg is listed for qualified researchers, laboratories, and research organisations that require clear product identification, batch documentation where available, and compliance-forward catalogue information from My UK Peptides (Research Only).

Purity & Third-Party Testing

Quality documentation may vary by batch. When a COA is available, it should be reviewed before laboratory use to confirm identity, lot details, and analytical information relevant to your research workflow.

Storage & Handling

Keep sealed, protected from direct light, and stored according to your laboratory standard operating procedures. Lyophilised material is typically stored cold and dry. Handling should be performed only by trained personnel using appropriate PPE, labelling, and documentation controls.

Frequently Asked Questions

What sizes are available?

Listed size option(s): 1.

Is this product for human use?

No. This product is supplied strictly for laboratory and in-vitro research only. It is not for human or animal consumption, application, injection, clinical use, or veterinary use.

Is a Certificate of Analysis available?

When available, COA or batch documentation should be referenced for identity and quality review before use in any research workflow.

Who should handle this product?

Only qualified laboratory personnel should handle this material under applicable institutional and legal requirements.

Research Use Only

For laboratory research use only. Not for human or veterinary use. This product is supplied strictly for research purposes only. It is not intended for human or animal consumption and is not intended for therapeutic, dietary, cosmetic, diagnostic, or veterinary use. Statements on this page have not been evaluated by the MHRA or FDA. This product is not intended to diagnose, treat, cure, or prevent any disease.

Specifications

    Research Use Only

    For laboratory research use only. Not for human or veterinary use.

    Not for Human Use

    Products are not intended for human or veterinary consumption.

    Quality Guaranteed

    Rigorous quality control on every batch from our state-of-the-art laboratory.

    © My UK Peptides (Research Only) — All rights reservedUK Peptides Supplier — Established 15 years! Research-use-only products.